DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and LOC100497187

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_017945658.1 Gene:LOC100497187 / 100497187 -ID:- Length:208 Species:Xenopus tropicalis


Alignment Length:143 Identity:62/143 - (43%)
Similarity:84/143 - (58%) Gaps:14/143 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 LRETNKYRRLHNANPLKMDEKLCSYAQEWADHLADLNKLETRPNPLYGENIM-------RVRRSK 207
            |...||||:.||..|::::.:|...||.||:||..:||::  .:...|||:.       |.....
 Frog    72 LEAHNKYRKKHNVPPMRLNAELSKSAQTWANHLLSINKMQ--HSGAGGENLYYSYSSRGRTLAGN 134

  Fly   208 FSVDQILKLWYQEKYNYDYLKPGFNLYTGHFTQLVWRESEFLGVGVACD-VSSIWIVCNYHPPGN 271
            .:||    .||.|..:|||.||||...||||||:||::|:.||||||.| ..:.::|..|.||||
 Frog   135 VAVD----AWYNEVKDYDYNKPGFKAATGHFTQVVWKDSKELGVGVATDGKGTFYVVGRYSPPGN 195

  Fly   272 VSEHFRENVLPRK 284
            |...|:||||..|
 Frog   196 VIGQFQENVLRPK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 54/129 (42%)
LOC100497187XP_017945658.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - mtm9372
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.