DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and crisp2-like

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001188271.2 Gene:crisp2-like / 100495843 -ID:- Length:207 Species:Xenopus tropicalis


Alignment Length:149 Identity:38/149 - (25%)
Similarity:62/149 - (41%) Gaps:34/149 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 ETNKYR-RLHN-----ANPLKMDEKLCSYAQEWADHLADLN------------------KLETRP 192
            ||..|. .|||     .:|...|    ....||:...| ||                  :::...
 Frog    33 ETQNYLVDLHNLLRRSVDPTAKD----MLKMEWSPGAA-LNAQNAAAKCVMQHSSATERQIQDPF 92

  Fly   193 NPLYGENIMRVRRSKFSVDQILKLWYQEKYNYDY-LKPGFNLYTGHFTQLVWRESEFLGVGVACD 256
            |.:.||||. |..:|......:..|:.|:.::.| :.|..:...||:||:.|.::..||.|:|..
 Frog    93 NYVCGENIY-VTTAKPDWAAAVNSWFNERNDFTYGVGPNSDKMIGHYTQVAWAKTYLLGCGLAFC 156

  Fly   257 VSSIW---IVCNYHPPGNV 272
            ..:.:   .:|:|.|.||:
 Frog   157 PGNYYPYVSICHYCPMGNM 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 37/147 (25%)
crisp2-likeNP_001188271.2 SCP 33..171 CDD:320774 35/143 (24%)
Crisp 189..>205 CDD:312162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.