DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and r3hdml

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_017953344.1 Gene:r3hdml / 100492715 XenbaseID:XB-GENE-1011048 Length:253 Species:Xenopus tropicalis


Alignment Length:169 Identity:50/169 - (29%)
Similarity:73/169 - (43%) Gaps:39/169 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 IPIIRRKPI-----KQAVLRETNKYRR-----LHNANPLKMDEKLCSYAQEWADHLADLNKLETR 191
            ||.||||..     ..|:|...|:.|.     ..|...:..||:|...|:.||:..    |.:..
 Frog    49 IPRIRRKRYISPRDMSALLDYHNQVRSKVFPPAANMEYMVWDERLAKSAESWANQC----KWDHG 109

  Fly   192 PNPL---YGENIMRVRRSKF-SVDQILKLWYQEKYNYDYLKPGF------NLYTG----HFTQLV 242
            ||.|   .|:| :.|...:: |:..::|.||.|:.:|.:..|..      |..||    |:||:|
 Frog   110 PNQLMRYIGQN-LSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMV 173

  Fly   243 WRESEFLGVGV-ACDVSSIW---------IVCNYHPPGN 271
            |..|..:|..| .|...::|         :||||...||
 Frog   174 WASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGN 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 44/155 (28%)
r3hdmlXP_017953344.1 CAP_R3HDML 63..208 CDD:349409 41/149 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.