DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and pi15

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_002937120.1 Gene:pi15 / 100489915 XenbaseID:XB-GENE-989406 Length:258 Species:Xenopus tropicalis


Alignment Length:215 Identity:58/215 - (26%)
Similarity:85/215 - (39%) Gaps:58/215 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 CLQCAAPKCKTSSRSSIQSKK--LKKDKKSLLKEFEIYKIPIIRRKP-IKQ----AVLRETNKYR 157
            |..|.....|:|..:|..|..  :|.|   |....:..|:|..|||. |.|    |::...|:.|
 Frog    17 CETCGLVLPKSSDLASAASNYTIIKPD---LSARLDAAKVPKARRKRYISQNDMIAIVEYHNQVR 78

  Fly   158 -----RLHNANPLKMDEKLCSYAQEWA-----DHLADLNKLETRPNPLY-----GENI-MRVRRS 206
                 ...|...:..||.|...|:.||     ||           .|.|     |:|: :|..|.
 Frog    79 GKVFPPAANMEYMVWDENLAKLAEAWAATCIWDH-----------GPSYLLKFLGQNLSVRTGRY 132

  Fly   207 KFSVDQILKLWYQEKYNYDYLKPG----------FNLYTGHFTQLVWRESEFLGVGV-ACDVSSI 260
            | |:.|::|.||.|..:|.:..|.          :.....|:||:||..:..:|..: .|...::
 Frog   133 K-SILQLVKPWYDEVKDYAFPYPQECNPRCPLRCYGPMCTHYTQMVWATTNRIGCAIHTCHNMNV 196

  Fly   261 W---------IVCNYHPPGN 271
            |         :||||.|.||
 Frog   197 WGAVWRRAVYLVCNYSPKGN 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 43/166 (26%)
pi15XP_002937120.1 CAP_PI15 67..212 CDD:349408 38/156 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.