DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and XB5812873

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_031758624.1 Gene:XB5812873 / 100127722 XenbaseID:XB-GENE-5812874 Length:272 Species:Xenopus tropicalis


Alignment Length:203 Identity:58/203 - (28%)
Similarity:86/203 - (42%) Gaps:57/203 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 HGKRCLQCAAPKCK-TSSRSSIQS-KKLKKDKKSLLKEFEIYKIPIIRRKPIKQAVLRETNKYRR 158
            :|...|.|.|...| ||.:.|::| .::..|.:|                 .:..::.:.|.||.
 Frog    32 NGFLLLLCLASLSKPTSEQDSVESFDEMSTDLES-----------------NRNFIVDKHNYYRS 79

  Fly   159 LHN---ANPLKM--DEKLCSYAQEWA-----DHLADLNKLETRP--NPLYGENIMRVRRSKF--S 209
            ..|   |:.|||  |....:.|:|||     .|    :.|..|.  ....|||||   .|.|  |
 Frog    80 WVNPPAADMLKMHWDNYYLAKAKEWALTCSFKH----SNLSFRQYGGEFAGENIM---NSYFRHS 137

  Fly   210 VDQILKLWYQEKYNYDY----LKPGFNLYTGHFTQLVWRESEFLGVGVACDVS-------SIWIV 263
            .:.::..|:.|..|::|    .|.|  ..||||||::|..:..|    ||.|:       :.:.|
 Frog   138 WEYVINYWFNEHVNWEYAVGTTKEG--AVTGHFTQIIWAPTHAL----ACYVAKCYGTPYNYFYV 196

  Fly   264 CNYHPPGN 271
            |.|:|.||
 Frog   197 CIYYPTGN 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 47/151 (31%)
XB5812873XP_031758624.1 CAP 65..201 CDD:412178 45/165 (27%)
Crisp 219..269 CDD:400739
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.