DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk10 and ASIC5

DIOPT Version :9

Sequence 1:NP_001033894.1 Gene:ppk10 / 3885617 FlyBaseID:FBgn0065110 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_059115.1 Gene:ASIC5 / 51802 HGNCID:17537 Length:505 Species:Homo sapiens


Alignment Length:486 Identity:115/486 - (23%)
Similarity:177/486 - (36%) Gaps:105/486 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HGFRYLTDSMLILFEKFLWLILLIASIYFCIIVCLSSIDRYYTKSTHIGIERNYIFWNTTLPSVT 93
            ||...:..:...: .:.|||::::.|:..........:..|:|..|...||..|: .....|:||
Human    48 HGIHNIVQNRSKI-RRVLWLVVVLGSVSLVTWQIYIRLLNYFTWPTTTSIEVQYV-EKMEFPAVT 110

  Fly    94 VCPVDRLNITYFADYCRNNGIKGPQRDILWDFL-------ENLANST----YINFQNIPQNEQID 147
            .|.::|......|.:    |:    ...||..:       |..||||    ..:|....||..|.
Human   111 FCNLNRFQTDAVAKF----GV----IFFLWHIVSKVLHLQEITANSTGSREATDFAASHQNFSIV 167

  Fly   148 QIIEDIGLKPEHYTELIYNLTYDRTYEPNFNERIRCMDGAMFIHVRQVLTEWGLCYLGNSKLTEE 212
            :.|.:.|....:.|.|      |..:   |.:.....|   |.|   |.||:|.|:..|...|.:
Human   168 EFIRNKGFYLNNSTLL------DCEF---FGKPCSPKD---FAH---VFTEYGNCFTFNHGETLQ 217

  Fly   213 YSSRYFIFGKYPEYNKYEYENIRLPYQVGSFFQKDTQYALLGFKGPAIIAFAHSAFEVMKVDSNS 277
            ...:..:.|:          .:.|.:.|..  :..|....|||....||...||..:|.:     
Human   218 AKRKVSVSGR----------GLSLLFNVNQ--EAFTDNPALGFVDAGIIFVIHSPKKVPQ----- 265

  Fly   278 DYAYDGILYDLSTEEITAEDNLEQDTTVAMRRCRFP-HESN----LTHFPFYTRNICQQECRINL 337
               :|| |..||...:.|...:.|..||..   .:| .|.|    |.:|..|:.:.|.:||:...
Human   266 ---FDG-LGLLSPVGMHARVTIRQVKTVHQ---EYPWGECNPNIKLQNFSSYSTSGCLKECKAQH 323

  Fly   338 AYKICKCIPHFYPNRIANPKPVCDYKTLRSCFP---HHASFFLKLYEENGKHENPAICYCEQNCH 399
            ..|.|.|:|...|.....    ||.:...||..   .|..|  |.....|.|.:.....||:..:
Human   324 IKKQCGCVPFLLPGYGIE----CDLQKYFSCVSPVLDHIEF--KDLCTVGTHNSSCPVSCEEIEY 382

  Fly   400 DSVVTMKSMNPMSGAKQLLGGIGSAVSVKTWPQSR---------------------LRRQVIFSL 443
            .:.::..|.......|.|         .|...|||                     .::|...|:
Human   383 PATISYSSFPSQKALKYL---------SKKLNQSRKYIRENLVKIEINYSDLNYKITQQQKAVSV 438

  Fly   444 TDLLVSIGGTAGLFLGFSVLGFVEVI-YFFT 473
            ::||..:||..|||.|.|::..:|:| |.||
Human   439 SELLADLGGQLGLFCGASLITIIEIIEYLFT 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk10NP_001033894.1 ASC 22..471 CDD:279230 112/482 (23%)
ASIC5NP_059115.1 ASC 41..466 CDD:279230 112/481 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.