DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk10 and ppk21

DIOPT Version :9

Sequence 1:NP_001033894.1 Gene:ppk10 / 3885617 FlyBaseID:FBgn0065110 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster


Alignment Length:551 Identity:123/551 - (22%)
Similarity:204/551 - (37%) Gaps:131/551 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KNSKYRNGLKIVINYFVLYFNNCCIHGFRYLTDSML--ILFEKFLWLILLIASIYFCIIVCLSSI 66
            |||:.......::.|...|.....:||.|||.|..:  .|..:.:||::|:.:....|:|.:...
  Fly    33 KNSRLGKLWHFMLPYLKDYAAESSVHGIRYLADPKMRNYLNIRVIWLLILLTTSIGAIVVYVDLN 97

  Fly    67 DRYYTKSTHIGIERNYI-FWNTTLPSVTVCPVDRLN----ITYFADYCRNNGIKGPQRDILWDFL 126
            :.|.|......|:...: .:....||:.:||.:|||    .|...|:.....:...|:|:...|.
  Fly    98 ELYQTVRIQTTIKNTMLPIFRIPFPSIGLCPRNRLNWKILETEAVDHFLGANVSAAQKDLFVKFF 162

  Fly   127 ENLANSTYINFQNIPQNEQIDQIIEDIGLKPEHYTELIYNLTYDRTYEPNFNERIRCMDGAMFIH 191
            ....:         |...:::::....|.|.  .|:.::.|.:....|.....:.||.|   ..|
  Fly   163 TAAGD---------PHLSRLNEMSNFFGNKT--LTDELHMLDHLDLREVYKFIQFRCQD---LFH 213

  Fly   192 --------------VRQVLTEWGLCYLGNSKLTEEYSSRYFIFGKYPEYNKYEYENIRLP-YQVG 241
                          :....||.|||::.|::::.  :||       .:..:.:|..:|.| |..|
  Fly   214 TCRWRGNPVNCCEVIEYQFTEAGLCFVFNTEISP--ASR-------QKAREDKYYPLRTPHYGEG 269

  Fly   242 S----FFQKDTQYALLGFKGPAIIA------------FAHSAFEVMKVDSNSDYAYDGILYDLST 290
            |    |.:.:..:...|.:|..::.            ..|.|...:.:                |
  Fly   270 SGLDLFLRLNRSFIRPGKRGINVMIKQPQQWSDVVRHVPHEAHTRISI----------------T 318

  Fly   291 EEITAEDNLEQDTTVAMRRCRF------PHESNLTHFPFYTRNICQQECRINLAYKICKCIPHFY 349
            ...|..|...:..|..:|||.|      ||..|...|.::..| |:..|.......:|||.|..:
  Fly   319 PRFTVTDERTRTVTPEIRRCIFGDEVDNPHYKNFPDFEYWVGN-CRSRCHQEHVLNLCKCSPSIF 382

  Fly   350 PNRIANPKPVCDYKTLRSCFPHHASFFLKLY------------EENGKHENP----AICYCEQNC 398
                   .|:.|.....:|   .||.|..||            ||:...:||    .||.|..:|
  Fly   383 -------FPISDKDNFTAC---KASDFKCLYDNRFTFSIERHPEEDDFVKNPFKESMICDCFTSC 437

  Fly   399 ----HDSVVTMKSM-----NPMSGAKQLLGGIGSAVSVKTW---PQSRLRRQVIFSLTDLLVSIG 451
                .|.|.|..::     :..:|..:|     .......|   .|:.:|    |:..:||.|.|
  Fly   438 SQLVFDRVFTTTTLDNNETDTEAGTMRL-----DIFYQSGWFIQYQTNMR----FTFVELLASFG 493

  Fly   452 GTAGLFLGFSVLGFVEVIYFFTIRIVFQILG 482
            |..|||||.|:|...|:.|:|:|.:...|.|
  Fly   494 GIIGLFLGASLLSAFELAYYFSIGLYLYIHG 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk10NP_001033894.1 ASC 22..471 CDD:279230 114/520 (22%)
ppk21NP_651704.2 ASC 51..513 CDD:279230 114/520 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.