DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk10 and Gr59e

DIOPT Version :9

Sequence 1:NP_001033894.1 Gene:ppk10 / 3885617 FlyBaseID:FBgn0065110 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster


Alignment Length:205 Identity:39/205 - (19%)
Similarity:65/205 - (31%) Gaps:74/205 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NSKYRNGLKIVINYFVLYFNNCCIHGFRYLTDSMLILFEKFLWLILLIASIYF-CIIVCLSSIDR 68
            :|.|...|.:.||.|:..:.:..:...|:|         ..||.:.|:..|:. .|:.||.    
  Fly     2 DSSYWENLLLTINRFLGVYPSGRVGVLRWL---------HTLWSLFLLMYIWTGSIVKCLE---- 53

  Fly    69 YYTKSTHIGIERNYIFWNTTLPSVTVCPVDRLNITYFADYCRNNGIKGPQRDILWDFLENLANST 133
                            :...:|::.       .:.|..::..|              :..:|...
  Fly    54 ----------------FTVEIPTIE-------KLLYLMEFPGN--------------MATIAILV 81

  Fly   134 YINFQNIP----QNEQIDQIIEDIGLKPEHYTELIYNLTYDRTYEPNFNERIRCMDGAMFIHVRQ 194
            |....|.|    ...||::||  .|||.: ...|:|.....||        :..|...:..|   
  Fly    82 YYAVLNRPLAHGAELQIERII--TGLKGK-AKRLVYKRHGQRT--------LHLMATTLVFH--- 132

  Fly   195 VLTEWGLCYL 204
                 |||.|
  Fly   133 -----GLCVL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk10NP_001033894.1 ASC 22..471 CDD:279230 33/188 (18%)
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 37/198 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.