DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk10 and Asic2

DIOPT Version :9

Sequence 1:NP_001033894.1 Gene:ppk10 / 3885617 FlyBaseID:FBgn0065110 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_037024.2 Gene:Asic2 / 25364 RGDID:2017 Length:563 Species:Rattus norvegicus


Alignment Length:541 Identity:111/541 - (20%)
Similarity:175/541 - (32%) Gaps:174/541 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IHGFRYLTDSMLILFEKF----LWLILLIASIYFCIIVCLSSIDRYYTKS--THIGIERNYIFWN 86
            :||.|::..........|    ||::....|:  .:::..||....|..|  :|..:.|.   |:
  Rat    66 LHGLRHMCAGRTAAGGSFQRRALWVLAFCTSL--GLLLSWSSNRLLYWLSFPSHTRVHRE---WS 125

  Fly    87 TTL--PSVTVCPVDRLNI-------TYFADYCRNNGIKGPQR-------DIL--------WDFLE 127
            ..|  |:||||..:.|..       .|:|.:..  |:..|.|       ::|        |  ..
  Rat   126 RQLPFPAVTVCNNNPLRFPRLSKGDLYYAGHWL--GLLLPNRTARPLVSELLRGDEPRRQW--FR 186

  Fly   128 NLANSTYI----NFQNIPQ--NEQIDQIIEDIGLKPEHYTELIYNLTYDRTYEP-NFNERIRCMD 185
            .||:....    :|:.|..  .:::...:||:.|..::..||.         .| ||:       
  Rat   187 KLADFRLFLPPRHFEGISAAFMDRLGHQLEDMLLSCKYRGELC---------GPHNFS------- 235

  Fly   186 GAMFIHVRQVLTEWGLCYLGNS------KLT------------------EEYSSRYFIFGKYPEY 226
                    .|.|::|.||:.||      .||                  :||         .|.:
  Rat   236 --------SVFTKYGKCYMFNSGEDGKPLLTTVKGGTGNGLEIMLDIQQDEY---------LPIW 283

  Fly   227 NKYEYENIRLPYQVGSFFQKDTQYAL-LGFKGPAIIAFAHSAFEVMKVDSNSDYAYDGILYDLST 290
            .:.|........:|....|.:..:.. |||                           |:.....|
  Rat   284 GETEETTFEAGVKVQIHSQSEPPFIQELGF---------------------------GVAPGFQT 321

  Fly   291 EEITAEDNLEQDTTVAMRRCRFPHESNLTHFPFYTRNICQQECRINLAYKICKCIPHFYPNRIAN 355
            ...|.|..|.. .......|| ..|..|..||.|:...|:.:|......:.|.|.....|    .
  Rat   322 FVATQEQRLTY-LPPPWGECR-SSEMGLDFFPVYSITACRIDCETRYIVENCNCRMVHMP----G 380

  Fly   356 PKPVCDYKTLRSCFPHHASFFLKLYEENGKHENPAICYCEQNC----HDSVVTMKSMNPMSGAKQ 416
            ..|.|..:..:.|    |...|.|..|  |..|  .|.|...|    ::..::|..:...:.||.
  Rat   381 DAPFCTPEQHKEC----AEPALGLLAE--KDSN--YCLCRTPCNLTRYNKELSMVKIPSKTSAKY 437

  Fly   417 L-----------------LGGIGSAVSVKTWPQSRLRRQVIFSLTDLLVSIGGTAGLFLGFSVLG 464
            |                 |.....|::.:|..|.:     .:.:..||..|||..|||:|.|:|.
  Rat   438 LEKKFNKSEKYISENILVLDIFFEALNYETIEQKK-----AYEVAALLGDIGGQMGLFIGASLLT 497

  Fly   465 FVEV---IYFFTIRIVFQILG 482
            .:|:   ||......:..:||
  Rat   498 ILELFDYIYELIKEKLLDLLG 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk10NP_001033894.1 ASC 22..471 CDD:279230 108/528 (20%)
Asic2NP_037024.2 ENaC 64..557 CDD:273304 111/541 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.