DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk10 and degt-1

DIOPT Version :9

Sequence 1:NP_001033894.1 Gene:ppk10 / 3885617 FlyBaseID:FBgn0065110 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_505703.3 Gene:degt-1 / 184921 WormBaseID:WBGene00009109 Length:852 Species:Caenorhabditis elegans


Alignment Length:355 Identity:69/355 - (19%)
Similarity:122/355 - (34%) Gaps:95/355 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GFRYLTDSMLILFEKFLWLILLIASIYFCIIVCLSSIDRYYTKSTHIGIERNY-IFWNTTLPSVT 93
            |||||.......| :.||..:::..|..........:..|:.|:. :...|:| ...|...|::.
 Worm    52 GFRYLHTRYKTWF-RVLWGFVVVFFIGLTFYQVFERVTYYFIKNP-LTTRRSYETLPNMYFPTIG 114

  Fly    94 VCPVDRLNITYFADYCRNNGIKGPQRDILWDFLENLANSTYINFQNIPQNEQIDQIIEDIGLKPE 158
            ||...::..:..|.       |.|      |.|..:.:....:..|..:.:::|: .:|:.:.. 
 Worm   115 VCNKMQIKASSVAS-------KNP------DLLRGMCSVLDESSSNSSRFDELDK-FDDVDILS- 164

  Fly   159 HYTELIYNLTY----DRTYEPNFNERIRCMDGAMFIHVRQVLTEWGLCYLGNSKLTEEYSSRYFI 219
                 :|..::    |......|.:...|.|     .:|.:.|.:||||        ..|....|
 Worm   165 -----LYRNSFQSADDLFVSCEFGKSGSCQD-----EIRPIYTPFGLCY--------SVSPNKTI 211

  Fly   220 FGKYPEYNKYEYENIRLPYQV--GSFFQKDTQYALLGFKGPAIIAFAHSAFEVMKVDSNSDYAYD 282
            ....||.......|:.: :::  |:..:            |.::...:..     ..|.|.|: :
 Worm   212 LRPGPETTLSLVLNLEV-HEIIPGTVVE------------PGVVLSIYDG-----ASSLSHYS-E 257

  Fly   283 GILYDLSTEEITAEDNLEQDTTVA-----MRRCRFPHESNLTHFPF-------YTRNICQQECRI 335
            ||             :||....|.     :|:.|. |||:......       |::..|:....:
 Worm   258 GI-------------HLEAGKVVTIPVNEVRKLRL-HESSCGSTKMESFSEKEYSKAACEWSVSV 308

  Fly   336 NLAYKICKCIPHFYPNRIANP--KPVCDYK 363
            ....|.|.|||      |.||  :.|.|.|
 Worm   309 KQIEKECGCIP------IRNPIYRGVFDNK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk10NP_001033894.1 ASC 22..471 CDD:279230 69/355 (19%)
degt-1NP_505703.3 ASC 44..>318 CDD:279230 60/333 (18%)
ASC <704..836 CDD:295594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.