DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17140 and POR1

DIOPT Version :9

Sequence 1:NP_001033896.1 Gene:CG17140 / 3885616 FlyBaseID:FBgn0260453 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_014343.1 Gene:POR1 / 855669 SGDID:S000005000 Length:283 Species:Saccharomyces cerevisiae


Alignment Length:226 Identity:47/226 - (20%)
Similarity:84/226 - (37%) Gaps:34/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 GWFTNNDLLSEIAVRGMNFGSRLYGLLKSTIGTKDEVSFQTKLKCGLERDPV-KVELVVPLY--- 210
            ||...|:|.:::....:            |.|.|:|:.  |.|..|:.:..| ......|.:   
Yeast    74 GWSNTNNLQTKLEFANL------------TPGLKNELI--TSLTPGVAKSAVLNTTFTQPFFTAR 124

  Fly   211 -------NEPLFLGYVLVAPVENWVLGYRTEYNFDEKGFDKHALCLGYNNGRTEVGLKLENFEDL 268
                   ..|.|:|.:.:|. |..|.|....|:.......::|:.|.|......:|..|.|.:..
Yeast   125 GAFDLCLKSPTFVGDLTMAH-EGIVGGAEFGYDISAGSISRYAMALSYFAKDYSLGATLNNEQIT 188

  Fly   269 RGSIFQRIGEAWAFAIKTNL-----YSSENVKQFAIGVQYDFQNGTMVKAKLREDSRMGFVYQSK 328
            ....||.:........|..:     .|:.|: :||  .:|.....:.||||:.:...:...|:..
Yeast   189 TVDFFQNVNAFLQVGAKATMNCKLPNSNVNI-EFA--TRYLPDASSQVKAKVSDSGIVTLAYKQL 250

  Fly   329 IGENIDVGYHLAFDGVDPIGGAHRIGVSWGF 359
            :...:.:|...:||.:......|::|.|..|
Yeast   251 LRPGVTLGVGSSFDALKLSEPVHKLGWSLSF 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17140NP_001033896.1 Porin3_VDAC 82..360 CDD:132767 47/226 (21%)
POR1NP_014343.1 Porin3_VDAC 3..282 CDD:132767 47/226 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344777
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11743
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.890

Return to query results.
Submit another query.