DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17140 and Vdac3

DIOPT Version :9

Sequence 1:NP_001033896.1 Gene:CG17140 / 3885616 FlyBaseID:FBgn0260453 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_006253420.1 Gene:Vdac3 / 83532 RGDID:621577 Length:284 Species:Rattus norvegicus


Alignment Length:293 Identity:78/293 - (26%)
Similarity:125/293 - (42%) Gaps:33/293 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PTYFHVGALAKDCLINGFKIGAWQMHCSTRT-DNDFYLNTFGEGYPTMKNVFGGMEVFKEVGNYS 146
            |||..:|..|||....|:..|..::...|:: ......:|.|..|.......|.:|...:|.||.
  Rat     5 PTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVMEFSTSGHAYTDTGKASGNLETKYKVCNYG 69

  Fly   147 T--SLGWFTNNDLLSEIAVRGMNFGSRLYGLLKSTIGT---KDEVSFQTKLKCGLERDPVKVELV 206
            .  :..|.|:|.|.:||     ::.::|...||.|:.|   .:......|||....||...|...
  Rat    70 LIFTQKWNTDNTLGTEI-----SWENKLAEGLKLTVDTIFVPNTGKKSGKLKASYRRDCFSVGSN 129

  Fly   207 VPL-YNEPLFLGYVLVAPVENWVLGYRTEYNFDEKGFDKHALCLGYNNGRTEVGLKLENFE---- 266
            |.: ::.|...|:.::| .|.|:.||  :.:||..   |..||  .||  ..:|.|.|:|:    
  Rat   130 VDIDFSGPTIYGWAVLA-FEGWLAGY--QMSFDTA---KSKLC--QNN--FALGYKAEDFQLHTH 184

  Fly   267 -----DLRGSIFQRIGEAWAFAIKTNLYSSENVKQFAIGVQYDFQNGTMVKAKLREDSRMGFVYQ 326
                 :..|||:||:.|....:|.....:..|..:|.|..:|.....|.:.||:...|.:|..|.
  Rat   185 VNDGTEFGGSIYQRVNEKIETSINLAWTAGSNNTRFGIAAKYRLDCRTSLSAKVNNASLIGLGYT 249

  Fly   327 SKIGENIDVGYHLAFDGVDPIGGAHRIGVSWGF 359
            ..:...:.:......||.:...|.|::|:  ||
  Rat   250 QSLRPGVKLTLSALVDGKNFNAGGHKVGL--GF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17140NP_001033896.1 Porin3_VDAC 82..360 CDD:132767 78/293 (27%)
Vdac3XP_006253420.1 Porin3_VDAC 5..283 CDD:132767 78/293 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11743
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.