DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17140 and Vdac2

DIOPT Version :9

Sequence 1:NP_001033896.1 Gene:CG17140 / 3885616 FlyBaseID:FBgn0260453 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_112644.1 Gene:Vdac2 / 83531 RGDID:621576 Length:295 Species:Rattus norvegicus


Alignment Length:289 Identity:62/289 - (21%)
Similarity:113/289 - (39%) Gaps:30/289 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PTYFHVGALAKDCLINGFKIGAWQMHCSTRTDNDFYLNTFGEGYPTMKNVFGGMEVFKEVGNYST 147
            |.|..:|..|:|....||..|..::...|::.:....:|.|........|.|.:|...:...|..
  Rat    17 PPYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVSGTLETKYKWCEYGL 81

  Fly   148 SL--GWFTNNDLLSEIAVRGMNFGSRLYGLLKSTIGTKDEVSFQT-------KLKCGLERD---- 199
            :.  .|.|:|.|.:|||:.     .::...||.|..|    :|..       |:|...:|:    
  Rat    82 TFTEKWNTDNTLGTEIAIE-----DQICQGLKLTFDT----TFSPNTGKKSGKIKSAYKRECINL 137

  Fly   200 --PVKVELVVPLYNEPLFLGYVLVAPVENWVLGYRTEYNFDEKGFDKHALCLGYNNGRTEVGLKL 262
              .|..:...|..:.....||      |.|:.||:..::..:....:....:||..|..::...:
  Rat   138 GCDVDFDFAGPAIHGSAVFGY------EGWLAGYQMTFDSAKSKLTRSNFAVGYRTGDFQLHTNV 196

  Fly   263 ENFEDLRGSIFQRIGEAWAFAIKTNLYSSENVKQFAIGVQYDFQNGTMVKAKLREDSRMGFVYQS 327
            .|..:..|||:|::.|.:..::.....|..|..:|.|..:|.......:.||:...|.:|..|..
  Rat   197 NNGTEFGGSIYQKVCEDFDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQ 261

  Fly   328 KIGENIDVGYHLAFDGVDPIGGAHRIGVS 356
            .:...:.:......||.....|.|::|::
  Rat   262 TLRPGVKLTLSALVDGKSFNAGGHKLGLA 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17140NP_001033896.1 Porin3_VDAC 82..360 CDD:132767 62/289 (21%)
Vdac2NP_112644.1 Porin3_VDAC 16..294 CDD:132767 62/289 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11743
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.