DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17140 and VDAC3

DIOPT Version :9

Sequence 1:NP_001033896.1 Gene:CG17140 / 3885616 FlyBaseID:FBgn0260453 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001190314.1 Gene:VDAC3 / 831361 AraportID:AT5G15090 Length:274 Species:Arabidopsis thaliana


Alignment Length:202 Identity:49/202 - (24%)
Similarity:82/202 - (40%) Gaps:47/202 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 VEIIPSPTSEGEMPTYFHVGALAKDCLINGFKIGAWQMHCSTRTDNDFYLN-TFGEGYPTMKNVF 133
            |.|..:.|::|.:    .:|.:|.....|.|....     ...||:..... ||.|..|.:|.:.
plant    39 VAITTTGTNKGSL----FLGDVATQVKNNNFTADV-----KVSTDSSLLTTLTFDEPAPGLKVIV 94

  Fly   134 ---------GGMEV--FKEVGNYSTSLGWFTNNDLLSEIAVRGMNFGSRLYGLLKSTIGTKDEVS 187
                     |..||  |.:....|||:| ||...:::...|.|.|      ||   ::||  :|:
plant    95 QAKLPDHKSGKAEVQYFHDYAGISTSVG-FTATPIVNFSGVVGTN------GL---SLGT--DVA 147

  Fly   188 FQTK------LKCGLE--RDPVKVELVVPLYNEPLFLGYV-LVAPVENWVLGYRTEYNFDEKGFD 243
            :.|:      ...|..  :|.:...|::....|.|...|. :|:|  :.|:|....:||..|   
plant   148 YNTESGNFKHFNAGFNFTKDDLTASLILNDKGEKLNASYYQIVSP--STVVGAEISHNFTTK--- 207

  Fly   244 KHALCLG 250
            ::|:.:|
plant   208 ENAITVG 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17140NP_001033896.1 Porin3_VDAC 82..360 CDD:132767 45/190 (24%)
VDAC3NP_001190314.1 Porin_3 4..267 CDD:279763 49/202 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11743
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.