DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17140 and VDAC5

DIOPT Version :9

Sequence 1:NP_001033896.1 Gene:CG17140 / 3885616 FlyBaseID:FBgn0260453 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_190561.1 Gene:VDAC5 / 824154 AraportID:AT3G49920 Length:226 Species:Arabidopsis thaliana


Alignment Length:244 Identity:49/244 - (20%)
Similarity:80/244 - (32%) Gaps:67/244 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 VGALAKDCLINGFKIGAWQMHCSTRTDNDFYLNTFGEGYPTMKNVFGGMEVFKEVGNYSTSLGWF 152
            :|..|||.|...:.           ||..|.::|         |...|      |...||:|   
plant    11 IGKYAKDLLTRDYS-----------TDQKFSIST---------NSVSG------VALTSTAL--- 46

  Fly   153 TNNDLL--SEIAVRGMNFGSRLYGLLKSTIGTKDEVSFQTKLKCGLERDPVKVELVVPLYNEPLF 215
             .|.:|  :.:|.:        |....:....|.:..|..|            .||.|:..    
plant    47 -KNGVLHAANVATQ--------YKYRNTFFDVKIDTDFNVK------------SLVYPMNK---- 86

  Fly   216 LGYVLVAPVENWVLGYRTEYNFDEKGFDKHALCLGYNNGRTEVGLKL-ENFEDLRGSIFQRIGEA 279
                .|:...|.:.||.|    ..:.|.|:.:.:........|.:.| :..:.::.|....:.|:
plant    87 ----FVSIDHNTLTGYDT----TSRTFTKYNVGVSVTKPDQCVSIILGDKGDSIKASYVYYLDES 143

  Fly   280 WAFAIKTNLYS--SENVKQFAIGVQYDFQNGTMVKAKLREDSRMGFVYQ 326
            ...|....:..  |.|.....:|..|...:.|.|||||..:.:.|.:.|
plant   144 TRSATVGEVIRKISTNETTVTVGGLYAVDHLTNVKAKLNSNGKFGALLQ 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17140NP_001033896.1 Porin3_VDAC 82..360 CDD:132767 49/244 (20%)
VDAC5NP_190561.1 Porin3_VDAC 5..225 CDD:132767 49/244 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11743
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.