DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17140 and VDAC1

DIOPT Version :9

Sequence 1:NP_001033896.1 Gene:CG17140 / 3885616 FlyBaseID:FBgn0260453 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_003365.1 Gene:VDAC1 / 7416 HGNCID:12669 Length:283 Species:Homo sapiens


Alignment Length:293 Identity:65/293 - (22%)
Similarity:115/293 - (39%) Gaps:32/293 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PTYFHVGALAKDCLINGFKIGAWQMHCSTRTDNDFYLNTFGEGYPTMKNVFGGMEV---FKEVGN 144
            |||..:|..|:|....|:..|..::...|:::|.....:.|........|.|.:|.   :.|.|.
Human     5 PTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGL 69

  Fly   145 YSTSLGWFTNNDLLSEIAV-----RG--MNFGSRLYGLLKSTIGTKDEVSFQTKLKCGLERDPVK 202
            ..|. .|.|:|.|.:||.|     ||  :.|.|.    .....|.|:     .|:|.|.:|:.:.
Human    70 TFTE-KWNTDNTLGTEITVEDQLARGLKLTFDSS----FSPNTGKKN-----AKIKTGYKREHIN 124

  Fly   203 V------ELVVPLYNEPLFLGYVLVAPVENWVLGYRTEYNFDEKGFDKHALCLGYNNGRTEVGLK 261
            :      ::..|.....|.|||      |.|:.||:..:...:....:....:||.....::...
Human   125 LGCDMDFDIAGPSIRGALVLGY------EGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTN 183

  Fly   262 LENFEDLRGSIFQRIGEAWAFAIKTNLYSSENVKQFAIGVQYDFQNGTMVKAKLREDSRMGFVYQ 326
            :.:..:..|||:|::.:....|:.....:..:..:|.|..:|.........||:...|.:|..|.
Human   184 VNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYT 248

  Fly   327 SKIGENIDVGYHLAFDGVDPIGGAHRIGVSWGF 359
            ..:...|.:......||.:...|.|::|:...|
Human   249 QTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEF 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17140NP_001033896.1 Porin3_VDAC 82..360 CDD:132767 65/293 (22%)
VDAC1NP_003365.1 Porin3_VDAC 4..282 CDD:132767 65/293 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11743
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.