DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17140 and zgc:56235

DIOPT Version :9

Sequence 1:NP_001033896.1 Gene:CG17140 / 3885616 FlyBaseID:FBgn0260453 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_956511.1 Gene:zgc:56235 / 393186 ZFINID:ZDB-GENE-040426-954 Length:281 Species:Danio rerio


Alignment Length:291 Identity:68/291 - (23%)
Similarity:120/291 - (41%) Gaps:32/291 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PTYFHVGALAKDCLINGFKIGAWQMHCSTRTDNDFYLNTFGEGYPTMKNVFGGMEV---FKEVGN 144
            |.|..:|..|||....|:..|..::...|::.|....||.|..........|.:|.   .|::| 
Zfish     5 PAYSDLGKSAKDIFSKGYGFGIVKLDLKTKSQNGVEFNTSGSTNTDTGKAAGSLETKYKLKDLG- 68

  Fly   145 YSTSLGWFTNNDLLSEIAVRGMNFGSRLYGLLKSTIGTKDEVSF-------QTKLKCGLERDPVK 202
            .|.:..|.|:|.|.:|::|.     .:|...||..:.|    ||       ..|||...:|:.|.
Zfish    69 LSFNQKWNTDNMLTTEVSVE-----DQLAEGLKVALDT----SFVPNTGKKSGKLKTSYKREFVN 124

  Fly   203 V----ELVVPLYNEPLFLGYVLVAPVENWVLGYRTEYNFDEKGFDKHALCLGYNNGRTEVGLKLE 263
            |    :...|:.:....|||      |.|:|||...::..:....::...|||..|..::...:.
Zfish   125 VSCDLDFEGPVVHSAAVLGY------EGWLLGYLVAFDTAKSKLVQNNFALGYKTGDFQLHTNVN 183

  Fly   264 NFEDLRGSIFQRIGEAWAFAIKTNLYSSENVKQFAIGVQYDFQNGTMVKAKLREDSRMGFVYQSK 328
            :..:..||::|::.:....|:.....:..|..:|.:..:|.......:.||:...|.:|..|...
Zfish   184 DGAEFGGSVYQKVSDQLETAVTLAWTAGSNNTRFGVAAKYQLDKDASLSAKVNNASLIGIGYTQS 248

  Fly   329 IGENIDVGYHLAFDGVDPIGGAHRIGVSWGF 359
            :...:.:......||.:...|.|::|:  ||
Zfish   249 LRPGVKLTLSALVDGKNFNTGGHKVGL--GF 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17140NP_001033896.1 Porin3_VDAC 82..360 CDD:132767 68/291 (23%)
zgc:56235NP_956511.1 Porin3_VDAC 4..280 CDD:132767 68/291 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11743
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.