DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17140 and porin

DIOPT Version :9

Sequence 1:NP_001033896.1 Gene:CG17140 / 3885616 FlyBaseID:FBgn0260453 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001033899.1 Gene:porin / 34500 FlyBaseID:FBgn0004363 Length:282 Species:Drosophila melanogaster


Alignment Length:284 Identity:77/284 - (27%)
Similarity:129/284 - (45%) Gaps:22/284 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PTYFHVGALAKDCLINGFKIGAWQMHCSTRTDNDFYLNTFGEGYPTMKNVFGGMEVFKEVGNYST 147
            |:|..:|..|:|....|:..|.|::...|:|.:....||.|........|||.:|...:|.:|..
  Fly     4 PSYSDLGKQARDIFSKGYNFGLWKLDLKTKTSSGIEFNTAGHSNQESGKVFGSLETKYKVKDYGL 68

  Fly   148 SL--GWFTNNDLLSEIAVR-----GMNFGSRLYGLLKSTIGTKDEVSFQTKLKCGLER----DPV 201
            :|  .|.|:|.|.:|:||:     |:...  |.|......|.|:.   :.|:..|.|.    ..|
  Fly    69 TLTEKWNTDNTLFTEVAVQDQLLEGLKLS--LEGNFAPQSGNKNG---KFKVAYGHENVKADSDV 128

  Fly   202 KVELVVPLYNEPLFLGYVLVAPVENWVLGYRTEYNFDEKGFDKHALCLGYNNGRTEVGLKLENFE 266
            .::|..||.|....|||      :.|:.||:|.::..:.....:...|||......:...:.:.:
  Fly   129 NIDLKGPLINASAVLGY------QGWLAGYQTAFDTQQSKLTTNNFALGYTTKDFVLHTAVNDGQ 187

  Fly   267 DLRGSIFQRIGEAWAFAIKTNLYSSENVKQFAIGVQYDFQNGTMVKAKLREDSRMGFVYQSKIGE 331
            :..||||||..:.....::.:..|..:..:||||.:|...:...|:||:...|::|..||.|:.:
  Fly   188 EFSGSIFQRTSDKLDVGVQLSWASGTSNTKFAIGAKYQLDDDASVRAKVNNASQVGLGYQQKLRD 252

  Fly   332 NIDVGYHLAFDGVDPIGGAHRIGV 355
            .:.:......||.:...|.|:|||
  Fly   253 GVTLTLSTLVDGKNFNAGGHKIGV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17140NP_001033896.1 Porin3_VDAC 82..360 CDD:132767 77/284 (27%)
porinNP_001033899.1 Porin3_VDAC 3..281 CDD:132767 77/284 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456956
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3126
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11743
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.