DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17140 and Porin2

DIOPT Version :9

Sequence 1:NP_001033896.1 Gene:CG17140 / 3885616 FlyBaseID:FBgn0260453 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001260364.1 Gene:Porin2 / 34499 FlyBaseID:FBgn0069354 Length:293 Species:Drosophila melanogaster


Alignment Length:303 Identity:75/303 - (24%)
Similarity:126/303 - (41%) Gaps:39/303 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PTYFHVGALAKDCLINGFKIGAWQMHCSTRTDNDFYLNTFGEGYPTMKN--VFGGMEVFKEVGNY 145
            |||..:|.||:|....|:..|.||:.|.|.|::.  :..|..|:.:..|  |.|.::...::.:.
  Fly     6 PTYPDLGKLARDLFKRGYHPGIWQIDCKTLTNSG--IEFFTTGFASQDNSKVTGSLQSKYKIEDQ 68

  Fly   146 STSL--GWFTNNDLLSEIAVRGMNFGSRLYGLLKSTIGTKDEVSFQT-------KLKCGLERDPV 201
            ..:|  .|.|.|.|..||    |:......||:.:.     |..||.       |.|.|..:|..
  Fly    69 GLTLTERWNTENWLFGEI----MHRDKLAQGLMLAV-----EAKFQPGSNEADGKFKMGYAQDNF 124

  Fly   202 KVELVVPLYNEPLFLGYVLVAPVENWVLGYRTEY---NFDEKGFDKHALCLGYNNGRTEVGLKLE 263
            .....:.|.:||: |...||...:.::.|..||:   |.:.||:   .:.||:.|....:..:|:
  Fly   125 NFLADIGLNSEPI-LNCSLVVGHKEFLGGVGTEFDVGNTELKGW---KVALGWTNETATLHGELK 185

  Fly   264 NFEDLRGSIFQRIGEAWAFAIKTNL-----YSSENVKQ-----FAIGVQYDFQNGTMVKAKLRED 318
            |.:....|:|.:..|.....|:...     .::|..:|     ..:|:.|..:...:|:||:...
  Fly   186 NGDTWLASLFYKASEKIDAGIEVTKGAGGGEAAEGEQQGGDVVVNLGMIYHLEEDALVRAKVNNL 250

  Fly   319 SRMGFVYQSKIGENIDVGYHLAFDGVDPIGGAHRIGVSWGFHC 361
            ..:|..|:.|:.:.|........|..:...|.||.||.....|
  Fly   251 VELGLGYEQKLRDGITASISAVLDCNNFKDGNHRFGVGIALQC 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17140NP_001033896.1 Porin3_VDAC 82..360 CDD:132767 74/300 (25%)
Porin2NP_001260364.1 Porin3_VDAC 6..292 CDD:132767 74/300 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456958
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3126
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11743
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.