DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17140 and SPAC1635.01

DIOPT Version :9

Sequence 1:NP_001033896.1 Gene:CG17140 / 3885616 FlyBaseID:FBgn0260453 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001342966.1 Gene:SPAC1635.01 / 2542750 PomBaseID:SPAC1635.01 Length:282 Species:Schizosaccharomyces pombe


Alignment Length:305 Identity:70/305 - (22%)
Similarity:104/305 - (34%) Gaps:56/305 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PTYFHVGALAKDCLINGFKIGAWQMHCSTRTDNDFYLNTFGEGYPTMKNVFGG-MEV-FKEVGNY 145
            |.|..:..|..|.|...|.:||..:...|...|....|.  .|....|.|..| :|. |.:..|.
pombe     4 PAYAAINKLCNDLLQRDFPVGATLLSVRTTAPNGVVFNV--SGNQDAKGVISGKLETSFNDKANG 66

  Fly   146 ST-SLGWFTNNDLLSEIAVRGMNFGSRLYGLLKSTIGTKDEVSFQTKLKCGLERDP---VKVELV 206
            .| |.||.|.|                   :|:|.:|..::.:....|.......|   .|..::
pombe    67 LTISQGWTTAN-------------------VLESKVGLSEQFAPGLHLNVNTTFSPATAAKTAIL 112

  Fly   207 VPLYNEPLFLGYVLVAPVENWVLGYRT----------EYNFD-EKG-FDKHALCLGYNNGRTEVG 259
            ...:..||...:..|..:|...||..|          |:.:| :|| ...:|..:||......|.
pombe   113 NLEHQHPLIHTHASVNALERKFLGDFTVGHEGFLAGAEFGYDVQKGNVSNYAATIGYLASPLSVA 177

  Fly   260 LKL-ENFEDLRGSIFQRIGE--------AWAFAIKTNLYSSENVKQFAIGVQYDFQNGTMVKAKL 315
            |:. .|....|.|.:.|:..        .|..|...|..:.|...::|:      ...|.||.|:
pombe   178 LQASNNLSVFRASYYHRVSSDVEAGGNVTWDAASTANAITLELASKYAL------DKDTFVKGKI 236

  Fly   316 REDSRMGFVYQSKIGENIDVGYHLAFDGVDPIG-GAHRIGVSWGF 359
            .........|...:...:.||..|..| ...:| .||:.|:|..|
pombe   237 NSAGVATLSYFQTVRPGVTVGLGLQLD-TQRLGQPAHKAGLSLAF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17140NP_001033896.1 Porin3_VDAC 82..360 CDD:132767 70/305 (23%)
SPAC1635.01NP_001342966.1 Porin3_VDAC 3..281 CDD:132767 70/305 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11743
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.