| Sequence 1: | NP_001033905.1 | Gene: | NimB3 / 3885611 | FlyBaseID: | FBgn0054003 | Length: | 122 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_016865476.1 | Gene: | MEGF10 / 84466 | HGNCID: | 29634 | Length: | 1195 | Species: | Homo sapiens |
| Alignment Length: | 50 | Identity: | 19/50 - (38%) |
|---|---|---|---|
| Similarity: | 28/50 - (56%) | Gaps: | 4/50 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 65 RQFSYCCDGYVNKGTSQNLKCEPICSEDCSNGLCLAPEECECAPGYYRSN 114 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| NimB3 | NP_001033905.1 | PLN03223 | <49..>106 | CDD:215637 | 15/40 (38%) |
| MEGF10 | XP_016865476.1 | EMI | 86..155 | CDD:462204 | 5/10 (50%) |
| EGF_Lam | 336..373 | CDD:214543 | |||
| EGF_CA | 597..642 | CDD:473889 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||