| Sequence 1: | NP_001033905.1 | Gene: | NimB3 / 3885611 | FlyBaseID: | FBgn0054003 | Length: | 122 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001268729.2 | Gene: | dkk1a / 799377 | ZFINID: | ZDB-GENE-090313-406 | Length: | 247 | Species: | Danio rerio |
| Alignment Length: | 32 | Identity: | 11/32 - (34%) |
|---|---|---|---|
| Similarity: | 16/32 - (50%) | Gaps: | 9/32 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 90 SEDCSNGLCLAPEECECAPGYYRSNKRCRFVL 121 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| NimB3 | NP_001033905.1 | PLN03223 | <49..>106 | CDD:215637 | 6/15 (40%) |
| dkk1a | NP_001268729.2 | Dkk_Cys1 | 13..114 | CDD:471087 | |
| Dkk1_Cys2 | 164..245 | CDD:437998 | 11/32 (34%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||