DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB3 and Pear1

DIOPT Version :10

Sequence 1:NP_001033905.1 Gene:NimB3 / 3885611 FlyBaseID:FBgn0054003 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_082736.1 Gene:Pear1 / 73182 MGIID:1920432 Length:1034 Species:Mus musculus


Alignment Length:93 Identity:30/93 - (32%)
Similarity:49/93 - (52%) Gaps:17/93 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LPTRTAAQFWSVDPVTQWRKEALAERGSGICYRTLTVETINPNSRNRQFSYCCDGYV-NKGTSQN 82
            ||..:..:.|. ||.|..:..        :.|||:..:.:..:||.|  ..||.||. ::|.   
Mouse    48 LPAESCHRPWE-DPHTCAQPT--------VVYRTVYRQVVKMDSRPR--LQCCRGYYESRGA--- 98

  Fly    83 LKCEPICSEDCSNGLCLAPEECECAPGY 110
              |.|:|:::|.:|.|:||.:|:||||:
Mouse    99 --CVPLCAQECVHGRCVAPNQCQCAPGW 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB3NP_001033905.1 PLN03223 <49..>106 CDD:215637 20/57 (35%)
Pear1NP_082736.1 EMI 24..94 CDD:462204 16/56 (29%)
EGF_CA 535..580 CDD:473889
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 823..883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 925..1034
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.