DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB3 and Megf10

DIOPT Version :10

Sequence 1:NP_001033905.1 Gene:NimB3 / 3885611 FlyBaseID:FBgn0054003 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001001979.1 Gene:Megf10 / 70417 MGIID:2685177 Length:1147 Species:Mus musculus


Alignment Length:121 Identity:25/121 - (20%)
Similarity:49/121 - (40%) Gaps:42/121 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 ILMLLAPLILINLIRKLKYLTP-FSFIANVLIGAGVGITLYYIVTDLPALSERKAMAEVQHLPMF 283
            :::.|.|    ::|.:|:...| |..:::       |:.::.::...||  .|..|..       
Mouse     1 MMLTLTP----SIIEELRMRDPSFPDVSH-------GVLIHRVIVGSPA--NRAGMKP------- 45

  Fly   284 FGTVIFALEGIGVVMSLE--NNMKNPQNFIGCPGVLNTGMSVVV-------MLYAT 330
             |.||..:.|:.|..|.|  |.::..::           ::|||       ||:.|
Mouse    46 -GDVIIEINGVKVNTSEEIYNAVRTSES-----------LNVVVRRGADLLMLHMT 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB3NP_001033905.1 PLN03223 <49..>106 CDD:215637
Megf10NP_001001979.1 Necessary for interaction with AP2M1, self-assembly and formation of the irregular, mosaic-like adhesion pattern. /evidence=ECO:0000250|UniProtKB:Q96KG7 1..857 25/121 (21%)
EMI 31..100 CDD:462204 18/80 (23%)
EGF_Lam 281..318 CDD:214543
EGF_CA 542..587 CDD:473889
Necessary for formation of large intracellular vacuoles. /evidence=ECO:0000250|UniProtKB:Q96KG7 945..1147
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1093..1147
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.