DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB3 and Megf6

DIOPT Version :10

Sequence 1:NP_001033905.1 Gene:NimB3 / 3885611 FlyBaseID:FBgn0054003 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_075244.1 Gene:Megf6 / 65049 RGDID:621188 Length:1574 Species:Rattus norvegicus


Alignment Length:99 Identity:26/99 - (26%)
Similarity:36/99 - (36%) Gaps:32/99 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 WRKEALAERGSGICYRTLTVETINPNSRNRQFSYCCDGYVNKGTSQNLKCEPIC-----SEDCSN 95
            |..||.|:|  .:|....:...:....|      |..|:.      .|.||..|     .:||.:
  Rat  1170 WFGEACAQR--CLCPTNASCHHVTGECR------CPPGFT------GLSCEQACQPGTFGKDCEH 1220

  Fly    96 GLCLAPEE----------CECAPGYYRSN--KRC 117
             ||..|.|          |.||.||:.:.  :||
  Rat  1221 -LCQCPGETWACDPASGVCTCAAGYHGTGCLQRC 1253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB3NP_001033905.1 PLN03223 <49..>106 CDD:215637 15/71 (21%)
Megf6NP_075244.1 EMI 41..113 CDD:462204
FXa_inhibition 127..162 CDD:464251
vWFA <154..202 CDD:469594
FXa_inhibition 209..245 CDD:464251
vWFA <237..285 CDD:469594
vWFA <284..325 CDD:469594
FXa_inhibition 338..373 CDD:464251
vWFA <371..410 CDD:469594
vWFA <413..452 CDD:469594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1555..1574
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.