DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB3 and Dkk4

DIOPT Version :10

Sequence 1:NP_001033905.1 Gene:NimB3 / 3885611 FlyBaseID:FBgn0054003 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001102802.1 Gene:Dkk4 / 502097 RGDID:1563172 Length:221 Species:Rattus norvegicus


Alignment Length:108 Identity:22/108 - (20%)
Similarity:31/108 - (28%) Gaps:56/108 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TQWRKEALAERGSGICYRTLTVETINPNSRNRQFSYCCDGYVNKGTSQNLKCEPICSEDCSNGLC 98
            |:|..|....:|             .|:::..|        .||| .:...|  :.:.||..|||
  Rat   116 TKWPAEENRPQG-------------KPSTKKSQ--------SNKG-QEGESC--LRTSDCGPGLC 156

  Fly    99 L-----------------------------APE---ECECAPG 109
            .                             |||   .|:|.||
  Rat   157 CARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPG 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB3NP_001033905.1 PLN03223 <49..>106 CDD:215637 15/88 (17%)
Dkk4NP_001102802.1 Dkk4_Cys1 37..91 CDD:438007
Dkk4_Cys2 128..221 CDD:438001 18/83 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.