DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB3 and NimC2

DIOPT Version :10

Sequence 1:NP_001033905.1 Gene:NimB3 / 3885611 FlyBaseID:FBgn0054003 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_788047.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster


Alignment Length:95 Identity:28/95 - (29%)
Similarity:36/95 - (37%) Gaps:44/95 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 RNRQFSY------CCDGYVNKGTSQNL-------------------------------KCEPICS 90
            |.|..:|      |||||:....::.:                               .|||.||
  Fly    52 RTRTETYLGFTDVCCDGYIRDENNECVPLCNDCGASGKCLLPNVCLCGKGYVSRKDHGHCEPECS 116

  Fly    91 EDCSNGLCLAPEECECAPGYYRSNKRCRFV 120
            |.|.||.|:||:||||..|:       |||
  Fly   117 ESCVNGKCVAPDECECLAGH-------RFV 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB3NP_001033905.1 PLN03223 <49..>106 CDD:215637 22/79 (28%)
NimC2NP_788047.1 None

Return to query results.
Submit another query.