DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB3 and NimA

DIOPT Version :9

Sequence 1:NP_001033905.1 Gene:NimB3 / 3885611 FlyBaseID:FBgn0054003 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster


Alignment Length:100 Identity:27/100 - (27%)
Similarity:38/100 - (38%) Gaps:15/100 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PTRTAAQFW--SVDPVTQWRKEALAERGSGICYRTLTVETINPNSRNRQFSYCCDGYVNKGTSQN 82
            |.|.....|  .:.|.....|..:.|        .:.|:.:|   :.|...:||.||....:...
  Fly    71 PVRVRTSSWCMEIPPRCATFKTEMRE--------VMRVQKLN---KTRTVRFCCQGYEGNLSDSQ 124

  Fly    83 LKCEPICSEDCSNGLCLAPEECECAPGYYRSNKRC 117
            ..|:|||...|..|.|:.|:.|.|..||.  .|.|
  Fly   125 ATCKPICRGGCGRGSCVMPDICSCEEGYI--GKHC 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB3NP_001033905.1 PLN03223 <49..>106 CDD:215637 16/56 (29%)
NimANP_001285918.1 EMI 52..116 CDD:284877 11/55 (20%)
EGF_2 170..200 CDD:285248
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.