DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB3 and DKK2

DIOPT Version :10

Sequence 1:NP_001033905.1 Gene:NimB3 / 3885611 FlyBaseID:FBgn0054003 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_055236.1 Gene:DKK2 / 27123 HGNCID:2892 Length:259 Species:Homo sapiens


Alignment Length:118 Identity:27/118 - (22%)
Similarity:42/118 - (35%) Gaps:46/118 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LGIELP----TRTAAQFWSVDPVTQWRKEALAERGS------GICYRTLTVETINPNSRNRQFS- 68
            ||.|.|    .|:|..:           :.||..||      |..|         |.|.:::.. 
Human    42 LGGETPGQAANRSAGMY-----------QGLAFGGSKKGKNLGQAY---------PCSSDKECEV 86

  Fly    69 --YCCDGYVNKGTSQNLKC---------EPIC--SEDCSNGLCLAPEECECAP 108
              ||...:  :|:|..:.|         :.:|  |..|:||:|:...|....|
Human    87 GRYCHSPH--QGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTP 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB3NP_001033905.1 PLN03223 <49..>106 CDD:215637 15/70 (21%)
DKK2NP_055236.1 Dkk2_Cys1 74..128 CDD:438009 13/64 (20%)
DKK-type Cys-1 78..127 11/50 (22%)
Dkk2_Cys2 175..258 CDD:437999
DKK-type Cys-2 183..256
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.