DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB3 and Dkk4

DIOPT Version :10

Sequence 1:NP_001033905.1 Gene:NimB3 / 3885611 FlyBaseID:FBgn0054003 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_663567.1 Gene:Dkk4 / 234130 MGIID:2385299 Length:221 Species:Mus musculus


Alignment Length:108 Identity:22/108 - (20%)
Similarity:31/108 - (28%) Gaps:56/108 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TQWRKEALAERGSGICYRTLTVETINPNSRNRQFSYCCDGYVNKGTSQNLKCEPICSEDCSNGLC 98
            |:|..|....:|             .|:::..|.|        || .:...|  :.:.||..|||
Mouse   116 TKWPAEENRPQG-------------KPSTKKSQSS--------KG-QEGESC--LRTSDCGPGLC 156

  Fly    99 L-----------------------------APE---ECECAPG 109
            .                             |||   .|:|.||
Mouse   157 CARHFWTKICKPVLREGQVCSRRGHKDTAQAPEIFQRCDCGPG 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB3NP_001033905.1 PLN03223 <49..>106 CDD:215637 15/88 (17%)
Dkk4NP_663567.1 Dkk4_Cys1 37..91 CDD:438007
DKK-type Cys-1 41..90
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..143 9/48 (19%)
Dkk4_Cys2 128..221 CDD:438001 18/83 (22%)
DKK-type Cys-2 145..218 13/57 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.