DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB3 and dsl-5

DIOPT Version :10

Sequence 1:NP_001033905.1 Gene:NimB3 / 3885611 FlyBaseID:FBgn0054003 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_502191.1 Gene:dsl-5 / 186492 WormBaseID:WBGene00001107 Length:302 Species:Caenorhabditis elegans


Alignment Length:49 Identity:14/49 - (28%)
Similarity:17/49 - (34%) Gaps:23/49 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 KCEPICSED----------------CSNGL----C---LAPEECECAPG 109
            |||..|.|:                |.|||    |   :.|:.|.|..|
 Worm   146 KCETFCDENKATNSGKHCNFQGKPSCLNGLTGSKCEKLIVPKLCNCENG 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB3NP_001033905.1 PLN03223 <49..>106 CDD:215637 12/44 (27%)
dsl-5NP_502191.1 DSL 138..182 CDD:460202 10/35 (29%)

Return to query results.
Submit another query.