DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB3 and M03F4.6

DIOPT Version :10

Sequence 1:NP_001033905.1 Gene:NimB3 / 3885611 FlyBaseID:FBgn0054003 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_508843.1 Gene:M03F4.6 / 180768 WormBaseID:WBGene00019759 Length:413 Species:Caenorhabditis elegans


Alignment Length:88 Identity:20/88 - (22%)
Similarity:33/88 - (37%) Gaps:27/88 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NPNSRNRQFSYCCDGYVNKGTSQNLKCEPICSEDCS---NGLCLA----------PEECE----- 105
            :|:|:.|..::.|......|...:|.|...|.:...   ||.||:          .::||     
 Worm   239 SPDSKCRPLTHFCFTVSEPGWKSSLCCPRPCRDPTPLYVNGQCLSIAHRGDPCQIDQQCEGGITM 303

  Fly   106 --------CAPGYYRSNKRCRFV 120
                    |..||:.:|.. ||:
 Worm   304 SCTLGSCQCKLGYHENNDE-RFL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB3NP_001033905.1 PLN03223 <49..>106 CDD:215637 14/72 (19%)
M03F4.6NP_508843.1 EB 113..159 CDD:460294
EB 272..321 CDD:460294 9/48 (19%)
EB 331..381 CDD:460294
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.