DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB3 and F56B3.2

DIOPT Version :10

Sequence 1:NP_001033905.1 Gene:NimB3 / 3885611 FlyBaseID:FBgn0054003 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_499983.2 Gene:F56B3.2 / 176902 WormBaseID:WBGene00018928 Length:432 Species:Caenorhabditis elegans


Alignment Length:94 Identity:18/94 - (19%)
Similarity:25/94 - (26%) Gaps:41/94 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 QFSYCCDGYVNKGTSQNLKC-------------------EPI------CSEDCS----------- 94
            |.:..|......|..:.::|                   .|:      ||.||.           
 Worm   280 QLNSACTSNAQCGGGEGMECMKGQCQCQQNFHPAVDVLTNPLKNPSQSCSRDCESENLSKDTSCM 344

  Fly    95 -----NGLCLAPEECECAPGYYRSNKRCR 118
                 |.||...::|....|.||....||
 Worm   345 KAVPLNSLCFIQKQCPQNSGCYRGRCMCR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB3NP_001033905.1 PLN03223 <49..>106 CDD:215637 13/80 (16%)
F56B3.2NP_499983.2 EB 112..157 CDD:460294
EB 265..312 CDD:460294 4/31 (13%)
EB 332..383 CDD:460294 10/42 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.