DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB3 and ced-1

DIOPT Version :10

Sequence 1:NP_001033905.1 Gene:NimB3 / 3885611 FlyBaseID:FBgn0054003 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_740922.1 Gene:ced-1 / 173064 WormBaseID:WBGene00000415 Length:1111 Species:Caenorhabditis elegans


Alignment Length:88 Identity:26/88 - (29%)
Similarity:43/88 - (48%) Gaps:12/88 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VDPVTQWRKEALAERGSGICYRTLTVETINPNSRNRQFSYCCDGYVNKGTSQNLKCEPICSEDCS 94
            ::|:|.::. .:.:||....|:...|:      :.:....|||||..   :::..|.|.|:..|.
 Worm    72 LNPLTGFQC-TVEKRGQKASYQRQLVK------KEKYVKQCCDGYYQ---TKDHFCLPDCNPPCK 126

  Fly    95 NGLCLAPEECECAPGYYRSNKRC 117
            .|.|:.|.:|||.|||  ..|.|
 Worm   127 KGKCIEPGKCECDPGY--GGKYC 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB3NP_001033905.1 PLN03223 <49..>106 CDD:215637 15/56 (27%)
ced-1NP_740922.1 None

Return to query results.
Submit another query.