DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34043 and PROZ

DIOPT Version :9

Sequence 1:NP_001033893.2 Gene:CG34043 / 3885606 FlyBaseID:FBgn0054043 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_016876301.1 Gene:PROZ / 8858 HGNCID:9460 Length:467 Species:Homo sapiens


Alignment Length:124 Identity:26/124 - (20%)
Similarity:50/124 - (40%) Gaps:28/124 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CFFPFVQNEYFRPSYQVL---VRKRNTQGDLIDGHCYGNIIQSRLVLTSASCLLSDNDFVNGREL 71
            |....:.:|...|..|.|   |:..|::|   ...|.|.||:...|||:|.|.|...:..     
Human   238 CACGVLTSEKRAPDLQDLPWQVKLTNSEG---KDFCGGVIIRENFVLTTAKCSLLHRNIT----- 294

  Fly    72 LNADELAVSFKGEDLNELIYLVGGIDVYPQFNFSSLDNDIAILSLSTQLPLSERNDIEW 130
                 :...|.....:.|:..:..:.|:.:::..:.:||:::|            ::||
Human   295 -----VKTYFNRTSQDPLMIKITHVHVHMRYDADAGENDLSLL------------ELEW 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34043NP_001033893.2 Tryp_SPc 24..211 CDD:304450 23/110 (21%)
Tryp_SPc 24..208 CDD:214473 23/110 (21%)
PROZXP_016876301.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147143
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.