DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34043 and proza

DIOPT Version :9

Sequence 1:NP_001033893.2 Gene:CG34043 / 3885606 FlyBaseID:FBgn0054043 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001314721.1 Gene:proza / 768176 ZFINID:ZDB-GENE-061013-403 Length:426 Species:Danio rerio


Alignment Length:137 Identity:35/137 - (25%)
Similarity:59/137 - (43%) Gaps:37/137 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GHCYGNIIQSRLVLTSASCLLSDNDFVNGRELLNADELAVSFK-------GEDLNELIYLVGGID 97
            |.|.|.|::..||||:|.|.....||          ::||..:       |:.|     .|..:.
Zfish   219 GFCSGVILKENLVLTTAQCARKHPDF----------QVAVGKRMTMFESSGQTL-----AVRQVH 268

  Fly    98 VYPQFNFSSLDNDIAILSLSTQL---------PLSERNDIEWVLVADYDI------TDFPLEEGV 147
            ::|..:..:.:||:|:|.|..::         .|.||:..:.||.|...:      .|.|.|:|:
Zfish   269 LHPLHSTGTAENDLALLELRDRIIFKKSVAAACLPERDFADRVLTAGQYMGVVTGWKDTPTEDGI 333

  Fly   148 ESYVWKN 154
            |.::..|
Zfish   334 EGHLLLN 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34043NP_001033893.2 Tryp_SPc 24..211 CDD:304450 35/137 (26%)
Tryp_SPc 24..208 CDD:214473 35/137 (26%)
prozaNP_001314721.1 GLA 28..90 CDD:214503
EGF_CA 91..127 CDD:238011
FXa_inhibition 140..164 CDD:291342
Tryp_SPc 199..423 CDD:304450 35/137 (26%)
Trypsin 199..420 CDD:278516 35/137 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580633
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.