DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34043 and Proz

DIOPT Version :10

Sequence 1:NP_001033893.2 Gene:CG34043 / 3885606 FlyBaseID:FBgn0054043 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_080110.1 Gene:Proz / 66901 MGIID:1860488 Length:399 Species:Mus musculus


Alignment Length:163 Identity:44/163 - (26%)
Similarity:67/163 - (41%) Gaps:53/163 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RPSYQVLVRKRNTQGDLIDGHCYGNIIQSRLVLTSASC-LLSDNDFVNGRELLNADELAVSFKGE 84
            :||:...||..|::|   :..|.|.::|...|||:|.| ||..|..|..    |.|: .:..|  
Mouse   190 QPSFPWQVRLTNSEG---EDFCAGVLLQEDFVLTTAKCSLLHSNISVKA----NVDQ-RIRIK-- 244

  Fly    85 DLNELIYLVGGIDVYPQFNFSSLDNDIAILSL-------STQLP--LSERNDIEWVLVADYDITD 140
                      ...|:.:::..|.:||:::|.|       |:.||  :.||:..|.||:       
Mouse   245 ----------STHVHMRYDEESGENDVSLLQLEEPLQCPSSGLPVCVPERDFAEHVLI------- 292

  Fly   141 FPLEEGVESYVWKN---------------ADGE 158
             |..||:.|....|               ||||
Mouse   293 -PGTEGLLSGWMLNGTHLATTPMLLSVTQADGE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34043NP_001033893.2 Tryp_SPc 24..208 CDD:473915 42/160 (26%)
ProzNP_080110.1 GLA 23..85 CDD:214503
EGF_CA <95..122 CDD:238011
FXa_inhibition 136..165 CDD:464251
Trypsin 192..>340 CDD:459667 43/161 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.