DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34043 and prozb

DIOPT Version :9

Sequence 1:NP_001033893.2 Gene:CG34043 / 3885606 FlyBaseID:FBgn0054043 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001313449.1 Gene:prozb / 558106 ZFINID:ZDB-GENE-120816-1 Length:395 Species:Danio rerio


Alignment Length:222 Identity:45/222 - (20%)
Similarity:75/222 - (33%) Gaps:75/222 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GH--CYGNIIQSRLVLTSASCL--LSDNDFVNGRELLNADELAVSFKGEDLNELIYLVGGIDVYP 100
            ||  |:|.|:..:.:||||:|:  |.|..|.          :||.     ::.....|.....:.
Zfish   200 GHDVCHGVILGQKSILTSATCMTALQDLHFT----------VAVG-----VSTAAVRVSSWTPHK 249

  Fly   101 QFNFSSLDNDIAILSLSTQLPLSERNDIEWVLVADYDITDFPL---EEGVESYVWKNADGENIYP 162
            :| .|..|:|:..|.|....|              .:|:..||   |:.....:...|..|.:..
Zfish   250 RF-LSGPDDDLCFLELQEPFP--------------PNISTVPLCLPEKDYSENILMRAGREGVAE 299

  Fly   163 G---YGVIHESNLVGIISYGLPLKN-----KRES---------------------------NLEV 192
            |   |..:...:....::....:.|     ||||                           :|..
Zfish   300 GGATYSYLSLDDCRDALNLTFVMTNKMFCMKRESAGSERCTVSSGSPAATLEGKTAFLTGVSLSA 364

  Fly   193 RRPN---RFTQLNPYLSWIYTIIQNTE 216
            .|..   .||:|:.||.|:..::..:|
Zfish   365 GRCGDTLLFTKLSRYLHWLRPLLLASE 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34043NP_001033893.2 Tryp_SPc 24..211 CDD:304450 44/215 (20%)
Tryp_SPc 24..208 CDD:214473 43/212 (20%)
prozbNP_001313449.1 GLA 25..88 CDD:214503
EGF_CA 89..125 CDD:238011
FXa_inhibition 139..167 CDD:291342
Tryp_SPc 182..384 CDD:304450 44/213 (21%)
Tryp_SPc 182..382 CDD:214473 43/211 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.