Sequence 1: | NP_001033893.2 | Gene: | CG34043 / 3885606 | FlyBaseID: | FBgn0054043 | Length: | 338 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001313449.1 | Gene: | prozb / 558106 | ZFINID: | ZDB-GENE-120816-1 | Length: | 395 | Species: | Danio rerio |
Alignment Length: | 222 | Identity: | 45/222 - (20%) |
---|---|---|---|
Similarity: | 75/222 - (33%) | Gaps: | 75/222 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 GH--CYGNIIQSRLVLTSASCL--LSDNDFVNGRELLNADELAVSFKGEDLNELIYLVGGIDVYP 100
Fly 101 QFNFSSLDNDIAILSLSTQLPLSERNDIEWVLVADYDITDFPL---EEGVESYVWKNADGENIYP 162
Fly 163 G---YGVIHESNLVGIISYGLPLKN-----KRES---------------------------NLEV 192
Fly 193 RRPN---RFTQLNPYLSWIYTIIQNTE 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34043 | NP_001033893.2 | Tryp_SPc | 24..211 | CDD:304450 | 44/215 (20%) |
Tryp_SPc | 24..208 | CDD:214473 | 43/212 (20%) | ||
prozb | NP_001313449.1 | GLA | 25..88 | CDD:214503 | |
EGF_CA | 89..125 | CDD:238011 | |||
FXa_inhibition | 139..167 | CDD:291342 | |||
Tryp_SPc | 182..384 | CDD:304450 | 44/213 (21%) | ||
Tryp_SPc | 182..382 | CDD:214473 | 43/211 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170580634 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |