DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34043 and CG9672

DIOPT Version :9

Sequence 1:NP_001033893.2 Gene:CG34043 / 3885606 FlyBaseID:FBgn0054043 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster


Alignment Length:234 Identity:49/234 - (20%)
Similarity:76/234 - (32%) Gaps:91/234 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 HCYGNIIQSRLVLTSASCLLSDNDFVNGRELLNADELAVSFKGEDLNELIYLVGGIDVY------ 99
            :|...||..|..||:.||:.||     |::...|   ||.|        ...||.:|:|      
  Fly    49 NCGAVIIGQRYALTALSCVCSD-----GKDTPWA---AVLF--------AVTVGSVDLYNGKQIR 97

  Fly   100 -------PQFNFSSLDNDIAILSLSTQLPLSERNDIEWVLVADYDITDFPLEEGVESYVWKN--- 154
                   |  |:|:|...||:|.|..::..||..:   .:....|:.  |:...||...|..   
  Fly    98 VEEITINP--NYSTLKTGIALLRLQEEITFSETVN---AIPLSQDVP--PMGSQVEVSGWGRTTE 155

  Fly   155 --------------------------------ADGENIYPGYG-------------VIHESNLVG 174
                                            ||.:.:..|:|             .:::..|||
  Fly   156 SEVNMHRTLQIGAAEVMAPRECALANRDELLVADDQVLCLGHGRRQGICSGDIGGPAVYQGQLVG 220

  Fly   175 IISYGLPLKNKRESNLEVRRPNRFTQLNPYLSWIYTIIQ 213
            :   |..:..:....|    |.||..:.....||...:|
  Fly   221 L---GAQILGECGGML----PERFISIAANYDWIQQQLQ 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34043NP_001033893.2 Tryp_SPc 24..211 CDD:304450 48/230 (21%)
Tryp_SPc 24..208 CDD:214473 46/227 (20%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 46/227 (20%)
Tryp_SPc 25..250 CDD:238113 48/230 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449091
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.