DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34043 and Proz

DIOPT Version :10

Sequence 1:NP_001033893.2 Gene:CG34043 / 3885606 FlyBaseID:FBgn0054043 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001296362.1 Gene:Proz / 306608 RGDID:1308666 Length:406 Species:Rattus norvegicus


Alignment Length:138 Identity:36/138 - (26%)
Similarity:61/138 - (44%) Gaps:38/138 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PSYQVLVRKRNTQGDLIDGHCYGNIIQSRLVLTSASC-LLSDNDFVNGRELLNADELAVSFKGED 85
            ||:...||..|::|   :..|.|.::|...|||:|.| ||..|               :|.|.:|
  Rat   198 PSFPWQVRLTNSEG---EDFCAGVLLQENFVLTTAKCSLLHSN---------------LSVKADD 244

  Fly    86 LNELIYLVGGIDVYPQFNFSSLDNDIAILSLS--TQLPL-------SERNDIEWVLVADYDITDF 141
            ..::  .:....|:.:::..:.:||:::|.|.  .|.|:       .||:..|.||:        
  Rat   245 DQQI--RIKSAHVHMRYDKETGENDVSLLELEKPLQCPIPALPVCVPERDFAEHVLI-------- 299

  Fly   142 PLEEGVES 149
            |..:||.|
  Rat   300 PGTKGVLS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34043NP_001033893.2 Tryp_SPc 24..208 CDD:473915 34/136 (25%)
ProzNP_001296362.1 GLA 27..89 CDD:214503
EGF_CA <99..126 CDD:238011
FXa_inhibition 140..169 CDD:464251
Trypsin 199..>347 CDD:459667 35/137 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.