DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34033 and Klrb1a

DIOPT Version :10

Sequence 1:NP_001033937.1 Gene:CG34033 / 3885602 FlyBaseID:FBgn0054033 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001010964.1 Gene:Klrb1a / 362443 RGDID:1586149 Length:223 Species:Rattus norvegicus


Alignment Length:145 Identity:30/145 - (20%)
Similarity:53/145 - (36%) Gaps:26/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYCLPIWLLLLLRADEANGKGICLYFSEKTASWFSALTICKSLHMCLADLNTEVTLFQMKSKINQ 72
            |.|...||         :.:..|.:.|:.:.:|..:|..|......|..:..:..|..:::...:
  Rat    92 LKCPKDWL---------SHRDKCFHVSQTSITWKESLADCGGKGATLLLVQDQEELRFLRNLTKR 147

  Fly    73 DDHEYWFGLNAHDKPTYRYVSNN-KSIEYSPHNSKLVN------NEGCVYVKQQNDFFKFESAKC 130
            ....:|.||      :|.....| |.|..|..||.:::      .:.|..|.|.    |..|..|
  Rat   148 ISSSFWIGL------SYTLSDENWKWINGSTLNSDVLSITGDTEKDSCASVSQD----KVLSESC 202

  Fly   131 REHRRFICTKTDECD 145
            .....::|.|..:|:
  Rat   203 DSDNIWVCQKELKCE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34033NP_001033937.1 CLECT 30..140 CDD:153057 24/116 (21%)
Klrb1aNP_001010964.1 LCK-binding motif 32..35
CLECT_NK_receptors_like 94..212 CDD:153063 27/136 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.