DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34033 and CG11211

DIOPT Version :10

Sequence 1:NP_001033937.1 Gene:CG34033 / 3885602 FlyBaseID:FBgn0054033 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster


Alignment Length:56 Identity:18/56 - (32%)
Similarity:25/56 - (44%) Gaps:8/56 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 PGTIGALLVERPAPVAEGFSQQAPLVYHYGHSTPSANSTFYDVLISKLAETTLERL 213
            |....|.:|.||.||      :...:|.:  .||:.|..|...|||:|.....||:
  Fly   562 PRVSEAAVVSRPHPV------KGECLYCF--ITPNQNEAFDKTLISELKVLVRERI 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34033NP_001033937.1 CLECT 30..140 CDD:153057
CG11211NP_610208.1 CLECT 49..160 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.