DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34033 and CG43055

DIOPT Version :10

Sequence 1:NP_001033937.1 Gene:CG34033 / 3885602 FlyBaseID:FBgn0054033 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001245867.1 Gene:CG43055 / 12798556 FlyBaseID:FBgn0262357 Length:180 Species:Drosophila melanogaster


Alignment Length:131 Identity:29/131 - (22%)
Similarity:51/131 - (38%) Gaps:29/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GICLYFSEK--TASWFSALTICKSLHMCLADLNTEVTLFQ--MKSKI-------NQDDHEYW-FG 80
            |...||.|.  ..:|:.|...|:       .:|.::..|:  .:.|:       |:.|..|| .|
  Fly    46 GDSYYFIENKLDRNWYDAFEACR-------QMNADLVAFEDRKEQKLIYHYLVDNEMDTTYWTAG 103

  Fly    81 LNAHDKPTYRYVSNNKSI------EYSPHNSKLVNNEGCVYVKQQNDFFK--FESAKCREHRRFI 137
            .:..::.::.:.||.:.:      ...|:|:|  |.|.||..|..:...|  .....|.....:|
  Fly   104 TDLAEQDSFVWFSNGQPVASDLWCNNEPNNAK--NEEHCVEYKPLHPEAKMGLNDRVCTFKTGYI 166

  Fly   138 C 138
            |
  Fly   167 C 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34033NP_001033937.1 CLECT 30..140 CDD:153057 28/129 (22%)
CG43055NP_001245867.1 CLECT 49..167 CDD:153057 26/126 (21%)

Return to query results.
Submit another query.