DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13516 and si:ch211-202h22.8

DIOPT Version :9

Sequence 1:NP_001033966.1 Gene:CG13516 / 3885599 FlyBaseID:FBgn0040658 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001278864.1 Gene:si:ch211-202h22.8 / 559550 ZFINID:ZDB-GENE-090313-78 Length:137 Species:Danio rerio


Alignment Length:131 Identity:32/131 - (24%)
Similarity:49/131 - (37%) Gaps:21/131 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PVAPAVSAPAIAPARPPPVVVVEQPAP----------------QPPTVVPTDTLHLGPNRSRV-- 97
            |..|..|.|.:...:..|..|..||.|                .|..||.|..:.:.|:.|.|  
Zfish     5 PALPPYSGPEVNQTQFTPYPVQYQPQPVYPPHPKDGFAPAVQSSPAPVVVTQVVMMPPSLSDVPG 69

  Fly    98 --LCPACGANKTTRMTHTANSRTHMVAGLLCLVGFCCCACFVPYCMNSCRTGNHYCRKCNTFLGA 160
              .||.|.....|...:.....|.::.|.|.::....| |.:|:|:::|:...|.|..|...:..
Zfish    70 QTKCPHCQQQIITETRYVNGLLTWLICGGLGILLIWPC-CLIPFCVSACKDVEHRCPNCKHVVFL 133

  Fly   161 Y 161
            |
Zfish   134 Y 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13516NP_001033966.1 zf-LITAF-like 96..162 CDD:287559 17/70 (24%)
si:ch211-202h22.8NP_001278864.1 zf-LITAF-like 68..135 CDD:287559 16/68 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578980
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54946
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.