DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13516 and cdip1

DIOPT Version :9

Sequence 1:NP_001033966.1 Gene:CG13516 / 3885599 FlyBaseID:FBgn0040658 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001092712.1 Gene:cdip1 / 557073 ZFINID:ZDB-GENE-070720-18 Length:213 Species:Danio rerio


Alignment Length:200 Identity:43/200 - (21%)
Similarity:60/200 - (30%) Gaps:71/200 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NAPTAPSPTPTRELGNPIANGLPIE-APPSYDVAVSVPVAPAVSAPAIAPARPPPVVVVEQPAPQ 78
            :|.|||..|     |.|..:.||.| .||.|:         |...|...    ||.|..|.|.|:
Zfish    28 SAGTAPVMT-----GPPQGHPLPPEYGPPPYE---------ATQQPGFV----PPHVPGEGPIPK 74

  Fly    79 P---PTVVP---------------TDTLHLGPNRS------------------------------ 95
            |   |..:|               |...:.||..|                              
Zfish    75 PMHMPMPMPHPHGGYYPPLGHFPHTMGEYAGPGPSHFAPGHTATVLAPPGAATTTVTVLQGEMFQ 139

  Fly    96 ----RVLCPACGANKTTRMTHTANSRTHMVAGLLCLVGFCCCACFVPYCMNSCRTGNHYCRKCNT 156
                :.:||.|.....||::|.......:|......||.....|.:|..::..:...|.|..|..
Zfish   140 SAPVQTVCPHCQQPIITRISHDIGLMNTLVCMFCFFVGCDLGCCLIPCLIDDLKDVTHTCPNCKG 204

  Fly   157 FLGAY 161
            ::..|
Zfish   205 YIYTY 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13516NP_001033966.1 zf-LITAF-like 96..162 CDD:287559 14/65 (22%)
cdip1NP_001092712.1 zf-LITAF-like 142..210 CDD:287559 14/67 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578945
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.