DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13516 and litaf

DIOPT Version :9

Sequence 1:NP_001033966.1 Gene:CG13516 / 3885599 FlyBaseID:FBgn0040658 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001002184.1 Gene:litaf / 431731 ZFINID:ZDB-GENE-040704-23 Length:163 Species:Danio rerio


Alignment Length:163 Identity:42/163 - (25%)
Similarity:68/163 - (41%) Gaps:26/163 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PTAPSPTPTRELGNPIANGLPIEAPPSYD-VAVSVPVAPAVSAPA--IAPARPPPVVVVEQPAPQ 78
            ||||....|..:|:|        .||||| ::.:.|..||...|.  :..:.|||....|.....
Zfish     6 PTAPPMENTTLVGHP--------PPPSYDEISGANPYYPAGPYPPADMKASGPPPYPTQEYNQMY 62

  Fly    79 PPT---------VVPTDTLHLGPN------RSRVLCPACGANKTTRMTHTANSRTHMVAGLLCLV 128
            |||         ||...|:::.|.      ..:..||.|..:..||:.:::.....:....|.:.
Zfish    63 PPTAQGQPVTSPVVAVQTVYVQPGLVFGNVPVQAHCPVCSQSVITRLEYSSGPLVWLSCAGLAVF 127

  Fly   129 GFCCCACFVPYCMNSCRTGNHYCRKCNTFLGAY 161
            |.....|.:|:|:...:...|:|..|::.||.:
Zfish   128 GCIYGCCLIPFCIEDLKDVTHHCPNCSSVLGVH 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13516NP_001033966.1 zf-LITAF-like 96..162 CDD:287559 15/66 (23%)
litafNP_001002184.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 7/24 (29%)
PPxY motif. /evidence=ECO:0000250|UniProtKB:Q99732 22..25 2/2 (100%)
zf-LITAF-like 93..161 CDD:287559 15/68 (22%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 116..136 3/19 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578982
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54946
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.