DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13516 and CG13559

DIOPT Version :10

Sequence 1:NP_001033966.1 Gene:CG13516 / 3885599 FlyBaseID:FBgn0040658 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_611801.1 Gene:CG13559 / 37720 FlyBaseID:FBgn0034870 Length:114 Species:Drosophila melanogaster


Alignment Length:109 Identity:28/109 - (25%)
Similarity:42/109 - (38%) Gaps:11/109 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VSAPAIAPARPPPVVVVEQPAPQPPTVVPTDTLHLGPNRSR-VLCPACGANKTTRMTHTANSRTH 119
            :|:.|..|:.|||  ..|:..........:.|..|..|.|. ::||.|.....|    |...|..
  Fly     1 MSSFARVPSTPPP--SYEEAMGWETRRSHSTTWLLAENTSSLMICPMCHDEIET----TTKIRRR 59

  Fly   120 MVAGL---LCLVGFCCCACFVPYCMNSC-RTGNHYCRKCNTFLG 159
            .:|.:   :.|...|...|::..|:..| ...:|.|..|...||
  Fly    60 WIAYVASGIVLFTTCGIGCWLIPCILDCFNEIHHSCPVCKATLG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13516NP_001033966.1 zf-LITAF-like 92..162 CDD:463165 19/73 (26%)
CG13559NP_611801.1 LITAF 38..107 CDD:197841 18/70 (26%)

Return to query results.
Submit another query.