DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13516 and CG30269

DIOPT Version :9

Sequence 1:NP_001033966.1 Gene:CG13516 / 3885599 FlyBaseID:FBgn0040658 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001303360.1 Gene:CG30269 / 37600 FlyBaseID:FBgn0050269 Length:144 Species:Drosophila melanogaster


Alignment Length:164 Identity:60/164 - (36%)
Similarity:77/164 - (46%) Gaps:30/164 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYPQVDFNAPTAP---SPTPTRELGNPIANGLPIEAPPSYDVAVSVPVAPAVSAPAIAPARPP-- 67
            :||.....||...   ..||.::      :.|| .||||||.|.:.|.  ..:.||..||...  
  Fly     4 VYPAAPLEAPKGSVELQATPEQQ------HLLP-PAPPSYDQATTTPA--ETTGPAPVPASTSTT 59

  Fly    68 --PVVVVEQPAPQPPTVVPTDTLHLGPNRSRVLCPACGANKTTRMTHTANSRTHMVAGLLCLVGF 130
              .||||    |..|         .||....|.||.|.....||::...|||||::|.:|||...
  Fly    60 QHTVVVV----PGSP---------YGPEPMDVQCPYCHNYARTRVSFKPNSRTHLIALILCLFQL 111

  Fly   131 CCCACFVPYCMNSCRTGNHYCRKCNTFLGAYNPK 164
            .||.| :|||::||...||||..|:.:||.|:.|
  Fly   112 YCCVC-LPYCISSCMNTNHYCGMCDRYLGTYDRK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13516NP_001033966.1 zf-LITAF-like 96..162 CDD:287559 30/65 (46%)
CG30269NP_001303360.1 REC114-like <34..111 CDD:291822 33/91 (36%)
zf-LITAF-like 74..142 CDD:287559 30/68 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448946
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DZV6
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4084
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 1 1.000 - - otm14624
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.