DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13516 and CG42565

DIOPT Version :9

Sequence 1:NP_001033966.1 Gene:CG13516 / 3885599 FlyBaseID:FBgn0040658 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001286738.1 Gene:CG42565 / 37598 FlyBaseID:FBgn0260767 Length:135 Species:Drosophila melanogaster


Alignment Length:156 Identity:53/156 - (33%)
Similarity:68/156 - (43%) Gaps:27/156 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YPQVDFNAPTAPSPTPTRELGNPIANGLPIEAPPSYDVAVSVPVAPAVSAPAIAPARPPPVVVVE 73
            |.:||       ||.|   ..:|.|.     |||:.||......:||...|.|      ||:...
  Fly     4 YKRVD-------SPPP---YSDPFAT-----APPAEDVMQQNLASPAHPNPVI------PVMAQT 47

  Fly    74 QPAPQPPTVVPTDTLHLGPN-RSRVLCPACGANKTTRMTHTANSRTHMVAGLLCLVGFCC--CAC 135
            .|..||.:|:...|..|..| |...:||.|.|....|:.|.....|:.:|.||||  |.|  |.|
  Fly    48 MPVLQPVSVMHHQTTVLVDNTRQGTICPHCNARIRLRVEHHPTGSTYCMAALLCL--FLCWPCVC 110

  Fly   136 FVPYCMNSCRTGNHYCRKCNTFLGAY 161
             .|.|.|.|...:.||..||:.||::
  Fly   111 -APCCCNCCYKTSQYCPNCNSCLGSF 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13516NP_001033966.1 zf-LITAF-like 96..162 CDD:287559 26/68 (38%)
CG42565NP_001286738.1 zf-LITAF-like 72..135 CDD:287559 26/65 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.