DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13516 and CG13511

DIOPT Version :9

Sequence 1:NP_001033966.1 Gene:CG13516 / 3885599 FlyBaseID:FBgn0040658 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001246466.1 Gene:CG13511 / 37597 FlyBaseID:FBgn0034759 Length:122 Species:Drosophila melanogaster


Alignment Length:146 Identity:39/146 - (26%)
Similarity:58/146 - (39%) Gaps:35/146 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 APSPTPTRELGNPIANGLPIEAPPSYDVAVSVPVAPAVSAPAIAPARPPPVVVVEQPAPQPPTVV 83
            ||.|..|..        :.:...|:|.|.|:  ..|..:...:.|...|                
  Fly     9 APEPADTEM--------VTVTTQPNYGVVVT--QIPVYTLNGVGPGAHP---------------- 47

  Fly    84 PTDTLHLGPNRSRVLCPACGANKTTRMTHTANSRTHMVAGLLCLVGFCCCACFV--PYCMNSCRT 146
                |.:|....||.||:|....||.:..:...:|||.|..|.:   |||..|:  ||.:|.|::
  Fly    48 ----LAVGCKPMRVRCPSCRGEVTTSLATSPTRKTHMCALTLYI---CCCWPFICLPYFINYCKS 105

  Fly   147 GNHYCRKCNTFLGAYN 162
            ..|||..|...:|:|:
  Fly   106 VQHYCPNCGCHIGSYS 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13516NP_001033966.1 zf-LITAF-like 96..162 CDD:287559 25/67 (37%)
CG13511NP_001246466.1 zf-LITAF-like 53..120 CDD:287559 25/69 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D136484at33392
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.